PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_017316-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB_related
Protein Properties Length: 430aa    MW: 48848.5 Da    PI: 5.773
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_017316-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.17.5e-12104146346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       W ++E+ ll+++  ++G g+W+ +a+++g ++  +qc++++ +
  AHYPO_017316-RA 104 DWNADEEILLLEGLGMYGLGNWAEVAEHVG-TKNKEQCINHYTN 146
                      6*****************************.***********88 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0250243.9E-12132427IPR016827Transcriptional adaptor 2
SMARTSM002911.4E-104186IPR000433Zinc finger, ZZ-type
PfamPF005691.1E-94377IPR000433Zinc finger, ZZ-type
SuperFamilySSF578502.59E-1445108No hitNo description
PROSITE profilePS5013510.9474588IPR000433Zinc finger, ZZ-type
CDDcd023351.36E-244593No hitNo description
PROSITE patternPS0135704774IPR000433Zinc finger, ZZ-type
SuperFamilySSF466892.09E-1397151IPR009057Homeodomain-like
PROSITE profilePS5129321.547100152IPR017884SANT domain
SMARTSM007175.0E-11101150IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-8102147IPR009057Homeodomain-like
PfamPF002493.1E-11104146IPR001005SANT/Myb domain
CDDcd001676.72E-11105147No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0016573Biological Processhistone acetylation
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 430 aa     Download sequence    Send to blast
MGRSRVHFDE DSTQRSRRKK NASSGESIES ALGGQGTGDG KKALYHCNYC NKDITGRIRI  60
KCAMCSDFDL CVECFSVGVD LKPHESNHDY RVMDSLSFPL ISSDWNADEE ILLLEGLGMY  120
GLGNWAEVAE HVGTKNKEQC INHYTNVYLN SPHFPRPDMS HVDGKNRNEL LAMAKENSED  180
TRGSTSFGDH IVKTEPTFSP TRVKIDELPK GGLSGRLLSV QNVDSHVNPI GKKPPKEEDS  240
SLVSLSGFNP KRREFDTEYD IDAEQLLAEM EFKDADTEEE RELKLKGVIH ATLTLDRLDE  300
RNRRKEFILE RNLLYPSSFE KELTPEEKAI CRRYDPFMRF HSKEDHEDML QAIIAEHRTR  360
KRILELEEAR AAGCRTSAEA DKYFEVKRRR EAEESARRAN QYSQHMSMAS ETGSESSSLI  420
SGQRETTLP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010686640.10.0PREDICTED: transcriptional adapter ADA2b
SwissprotQ9ATB41e-155TAD2B_ARATH; Transcriptional adapter ADA2b
TrEMBLA0A0J8BWJ70.0A0A0J8BWJ7_BETVU; Uncharacterized protein
STRINGVIT_00s0194g00130.t010.0(Vitis vinifera)